PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK42158.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family ARF
Protein Properties Length: 1146aa    MW: 126733 Da    PI: 6.8353
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK42158.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B372.45.5e-23115216199
                 EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..E CS
          B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelv 93 
                 f+k+lt sd++++g +++p++ ae++      +++++++ +l+ +d + ++W++++iyr++++r++lt+GW+ Fv+ ++L +gD+v+F +  + +++l+
  KFK42158.1 115 FCKTLTASDTSTHGGFSVPRRAAEKIfpaldfSMQPPCQ-ELVAKDIHDNTWTFRHIYRGQPKRHLLTTGWSVFVSTKRLFAGDSVLFIR--DGKAQLL 210
                 99*****************************98888885.9************************************************5..4678889 PP

                 EEEE-S CS
          B3  94 vkvfrk 99 
                 ++++r+
  KFK42158.1 211 LGIRRA 216
                 999997 PP

2Auxin_resp1163.3e-38241323183
  Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                 aaha +++s+F+++YnPra+++eFvv+++k+ ka++ +vs+GmRf+m fete++  rr++Gtv+g+sdldpvrW+ S+Wr+L+
  KFK42158.1 241 AAHANANNSPFTIFYNPRAAPAEFVVPLAKYTKAMYAQVSLGMRFRMIFETEECGVRRYMGTVTGISDLDPVRWKSSQWRNLQ 323
                 799******************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019361.44E-42105244IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.4E-41109230IPR015300DNA-binding pseudobarrel domain
CDDcd100171.04E-19114215No hitNo description
SMARTSM010199.7E-23115217IPR003340B3 DNA binding domain
PfamPF023623.0E-21115216IPR003340B3 DNA binding domain
PROSITE profilePS5086312.125115217IPR003340B3 DNA binding domain
PfamPF065072.6E-33241323IPR010525Auxin response factor
PfamPF023091.3E-910161105IPR033389AUX/IAA domain
PROSITE profilePS5174526.95610191112IPR000270PB1 domain
SuperFamilySSF542771.13E-810321097No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009638Biological Processphototropism
GO:0009723Biological Processresponse to ethylene
GO:0009734Biological Processauxin-activated signaling pathway
GO:0009785Biological Processblue light signaling pathway
GO:0010311Biological Processlateral root formation
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048366Biological Processleaf development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 1146 aa     Download sequence    Send to blast
MCAGDRRNIN SELWHACAGP LISLPPAGSL VVYFPQGHSE QVAASMQKQT DFIPSYPNLP  60
SKLICMLHNV TLNADPETDE VYAQMTLQPV NKYDRDALLA SDMGLKLNRQ PNEFFCKTLT  120
ASDTSTHGGF SVPRRAAEKI FPALDFSMQP PCQELVAKDI HDNTWTFRHI YRGQPKRHLL  180
TTGWSVFVST KRLFAGDSVL FIRDGKAQLL LGIRRANRQQ PALSSSVISS DSMHIGVLAA  240
AAHANANNSP FTIFYNPRAA PAEFVVPLAK YTKAMYAQVS LGMRFRMIFE TEECGVRRYM  300
GTVTGISDLD PVRWKSSQWR NLQIGWDESA AGDRPSRVSV WDIEPVLTPF YICPPPFFRP  360
RFSGQPGMPD DESDMESALK RAMPWLDNSF EMKDSSSTIF PGLSLVQWMN MQQQNGQMPA  420
GAAAQPGFFP SMLSPTAGMH NNLGGTDDPS KLLSFQTPQG GISSSNLQFN KPNQQGPMSQ  480
LPQPPTTLSQ QQQLQQLLHS SLNQQQQQQQ TQSQQQQQQQ QQQSLQQHHQ QALQQQHQQA  540
LQQQTQQQQL RTQPVQSQSQ PQTQPQQLQP QKLQQPQLPQ NQLYNGQQAA PQLQAQQASM  600
HHLQPQLVSG SMASSVIVPP SNSLNQSFQQ QQQSKQHHQG HHHLGASTSQ SSLIETSKSS  660
SNPMSMTAQD TQFPRQVEQQ QPPGLVKGHN QQTLLQQKAH QPQSQSQTQV QQMYQQSLLE  720
QPHLQFQLLQ RLQQQQQPQQ QFLSPGSSML QSQLLHQQLQ SQQMQQLPPL SQSQQFPSSC  780
TNNGLSTLQP PQMLVNRPQD KQNQTVGGGV RAYSGITDGG DAPSSSTSPS TNNCQISSSG  840
FLNRSQSGPA ILIPDVAADM SGNLVQDLYS KSDTRLKPDL VCQQKSKATL TDHQLEPSAS  900
GTSFGLDGGD NNRQQNFLAP SFGLDSDSRN SLLGGANVDN SFVPDTLLSR GYDSQKDLQN  960
MLSNYGGVTN DIGTEMSTSA VRTQSFGIPN VPAISNDVAV NDAGVLGGGL WAAQAQRMRT  1020
YTKVQKRGSV GRSIDVNRYR GYDELRHDLA RMFGIEGQLE DPQTSDWKLV YVDHENDILL  1080
VGDDPWEEFV NCVQSIKILS SAEVQQMSLD GNFAGLPVTN QACSGGDSGN AWRGHYDDNS  1140
ATSFNR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldu_A1e-168934451388Auxin response factor 5
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that binds specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). {ECO:0000256|RuleBase:RU004561}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF0421950.0AF042195.1 Arabidopsis thaliana auxin response factor 7 (ARF7) mRNA, complete cds.
GenBankAY6697890.0AY669789.1 Arabidopsis thaliana clone C105344 ARF7 (At5g20730) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006400643.10.0hypothetical protein EUTSA_v10012513mg
TrEMBLA0A087HJ560.0A0A087HJ56_ARAAL; Auxin response factor
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM26292665
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G20730.20.0ARF family protein